TBLASTX 2.15.0+ Reference: Stephen F. Altschul, Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Database: Niben101 cDNA Blast Database 57,140 sequences; 82,582,885 total letters Query= Nbe.v1.1.chr08g00050 Length=351 Score E Sequences producing significant alignments: (Bits) Value N Niben101Scf14009g02003.1 34.1 0.20 1 Niben101Scf02413g00004.1 24.4 2.2 2 Niben101Scf36099g00004.1 24.0 3.2 2 Niben101Scf02969g00003.1 29.5 4.9 1 Niben101Scf01119g00006.1 29.0 6.6 1 Niben101Scf03045g13003.1 28.6 9.1 1 Niben101Scf17290g01006.1 28.6 9.1 1 >Niben101Scf14009g02003.1 Length=12374 Score = 34.1 bits (68), Expect = 0.20 Identities = 14/59 (24%), Positives = 27/59 (46%), Gaps = 0/59 (0%) Frame = +2/+1 Query 65 RQSKSNTWLRPFNSTWLRSSLLTVNPMSTTVERKTQRESKSTIWLRPFNSTWIRSSI*N 241 R K+ W R + WLR +L + ++ +R K+ +W R + +R ++ N Sbjct 6355 RNLKNQLWKRNLKNQWLRRNLKNQQLRKKMMNQQCKRNLKNQLWKRNLKNQQLRRNLTN 6531 >Niben101Scf02413g00004.1 Length=396 Score = 24.4 bits (47), Expect(2) = 2.2 Identities = 9/19 (47%), Positives = 14/19 (74%), Gaps = 0/19 (0%) Frame = +3/+1 Query 24 QSTQCKL*QNERLDDSQSQ 80 QS+QC + +NE L+D S+ Sbjct 76 QSSQCSVVENEVLEDEVSE 132 Score = 22.1 bits (42), Expect(2) = 2.2 Identities = 6/17 (35%), Positives = 11/17 (65%), Gaps = 0/17 (0%) Frame = +2/+1 Query 95 PFNSTWLRSSLLTVNPM 145 P +TW R + +T+N + Sbjct 280 PTKTTWKRKAAITINKL 330 >Niben101Scf36099g00004.1 Length=3352 Score = 24.0 bits (46), Expect(2) = 3.2 Identities = 10/22 (45%), Positives = 12/22 (55%), Gaps = 0/22 (0%) Frame = +3/+3 Query 240 TAKVIATNSRPNVDYGRTKDST 305 T +V SRPN DY + ST Sbjct 2373 TLEVGPAGSRPNGDYSKNSGST 2438 Score = 23.1 bits (44), Expect(2) = 3.2 Identities = 8/17 (47%), Positives = 11/17 (65%), Gaps = 0/17 (0%) Frame = +1/+3 Query 127 ANSQPNVDYGRTKDSTR 177 A S+PN DY + ST+ Sbjct 2304 AGSRPNGDYSKNSGSTK 2354 >Niben101Scf02969g00003.1 Length=1629 Score = 29.5 bits (58), Expect = 4.9 Identities = 14/51 (27%), Positives = 23/51 (45%), Gaps = 0/51 (0%) Frame = +1/+1 Query 7 KSITANNRPNVNYSRTKDSTTVKVKHMAKAIQFYMAKVIAANSQPNVDYGR 159 K IT N RP + TT+++ + + + FY A + N+D R Sbjct 655 KDITGNPRPFRRLRTACEKTTIEIDSLYEGVDFYSTITRARFEELNMDLFR 807 >Niben101Scf01119g00006.1 Length=1974 Score = 29.0 bits (57), Expect = 6.6 Identities = 12/27 (44%), Positives = 17/27 (63%), Gaps = 0/27 (0%) Frame = +2/-2 Query 134 VNPMSTTVERKTQRESKSTIWLRPFNS 214 VNP++ T RKT R+ + I P+NS Sbjct 1457 VNPLAYTRARKTDRQRRLFIVTAPYNS 1377 >Niben101Scf03045g13003.1 Length=1635 Score = 28.6 bits (56), Expect = 9.1 Identities = 8/16 (50%), Positives = 12/16 (75%), Gaps = 0/16 (0%) Frame = +2/-3 Query 188 TIWLRPFNSTWIRSSI 235 T+WL P+ +W+R SI Sbjct 1498 TLWLNPYIKSWVRHSI 1451 >Niben101Scf17290g01006.1 Length=596 Score = 28.6 bits (56), Expect = 9.1 Identities = 15/40 (38%), Positives = 22/40 (55%), Gaps = 0/40 (0%) Frame = +2/+1 Query 101 NSTWLRSSLLTVNPMSTTVERKTQRESKSTIWLRPFNSTW 220 NST LRS+ L V ++TT + QR S+ + + N W Sbjct 466 NSTELRSASLDVIAIATTSANEHQRLSEFSFFSCVINKKW 585 Lambda K H 0.318 0.134 0.401 Effective search space used: 1825983164 Database: Niben101 cDNA Blast Database Posted date: Dec 5, 2024 9:47 AM Number of letters in database: 82,582,885 Number of sequences in database: 57,140 Matrix: BLOSUM62 Neighboring words threshold: 13 Window for multiple hits: 40